EPCR_MOUSE Q64695
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64695
Recommended name:Endothelial protein C receptor
EC number:
Alternative names:(Activated protein C receptor) (APC receptor) (Centrocyclin) (Centrosomal protein CCD41) (Endothelial cell protein C receptor) (CD antigen CD201)
Cleaved into:
GeneID:19124
Gene names (primary ):Procr
Gene names (synonym ):Epcr
Gene names (ORF ):
Length:242
Mass:27189
Sequence:MLTKFLPLLLLLLPGCALCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSLVLGILMGCFIIAGVAVGIFMCTSGRRC
Tissue specificity:Expressed in endothelial cells.
Induction:
Developmental stage:
Protein families: