RASD1_MOUSE O35626
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35626
Recommended name:Dexamethasone-induced Ras-related protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:19416
Gene names (primary ):Rasd1
Gene names (synonym ):Dexras1
Gene names (ORF ):
Length:280
Mass:31684
Sequence:MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSVHSDLMYIREKTSVGSQAKDKERCVIS
Tissue specificity:Expressed in brain, heart, kidney and liver. {ECO:0000269|PubMed:9452419}.
Induction:By dexamethasone. {ECO:0000269|PubMed:9452419}.
Developmental stage:
Protein families:Small GTPase superfamily, RasD family