IL24_MOUSE   Q925S4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q925S4

Recommended name:Interleukin-24

EC number:

Alternative names:(IL-24) (IL-4-induced secreted protein) (Melanoma differentiation-associated gene 7 protein) (MDA-7) (Th2-specific cytokine FISP)

Cleaved into:

GeneID:93672

Gene names  (primary ):Il24

Gene names  (synonym ):Mda7

Gene names  (ORF ):

Length:181

Mass:20812

Sequence:MSWGLQILPCLSLILLLWNQVPGLEGQEFRSGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL

Tissue specificity:Selectively expressed by Th2 cells. {ECO:0000269|PubMed:11342597}.

Induction:By IL-4. {ECO:0000269|PubMed:11342597}.

Developmental stage:

Protein families:IL-10 family


   💬 WhatsApp