SKAP2_MOUSE   Q3UND0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UND0

Recommended name:Src kinase-associated phosphoprotein 2

EC number:

Alternative names:(Pyk2/RAFTK-associated protein) (SKAP55 homolog) (SKAP-HOM) (Src family-associated phosphoprotein 2) (Src kinase-associated phosphoprotein 55-related protein) (Src-associated adapter protein with PH and SH3 domains)

Cleaved into:

GeneID:54353

Gene names  (primary ):Skap2

Gene names  (synonym ):Prap Ra70 Saps Scap2 Skap55r

Gene names  (ORF ):

Length:358

Mass:40712

Sequence:MPNPSCTSSPGPLPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQDKGDAEDGDEYDDPFAGPADTISLASERYDKDDDGPSDGNQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLGSDVIPEDDEERGELYDDVDHPAAVSSPQRSQPIDDEIYEELPEEEEDTASVKMDEQGKGSRDSVHHTSGDKSTDYANFYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYLMEMYDI

Tissue specificity:Expressed in kidney, lung, liver, spleen, bone marrow and testis. Present in T-cells, B-cells, and all cells of the myelomonocytic lineage. Present in all brain regions, with highest levels in neurons from the Purkinje cell layer, hippocampal gyrus, cortex and substantia nigra (at protein level). {ECO:0000269|PubMed:11063873, ECO:0000269|PubMed:12893833, ECO:0000269|PubMed:15894167, ECO:0000269|PubMed:16135797}.

Induction:By IL-6 in myeloid cells. {ECO:0000269|PubMed:11063873}.

Developmental stage:

Protein families:SKAP family


   💬 WhatsApp