IMPA1_MOUSE   O55023


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O55023

Recommended name:Inositol monophosphatase 1

EC number:EC 3.1.3.25

Alternative names:(IMP 1) (IMPase 1) (D-galactose 1-phosphate phosphatase) (Inositol-1(or 4)-monophosphatase 1) (Lithium-sensitive myo-inositol monophosphatase A1)

Cleaved into:

GeneID:

Gene names  (primary ):Impa1

Gene names  (synonym ):

Gene names  (ORF ):

Length:277

Mass:30436

Sequence:MADPWQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVAAGEKTVFTESPTWFIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKLCSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKEIEIIPLQRDDES

Tissue specificity:Mostly expressed in brain, small intestine, testis, kidney, and spleen (at protein level). {ECO:0000269|PubMed:17068342}.

Induction:By lithium Li(+) in hippocamp. {ECO:0000269|PubMed:12877981}.

Developmental stage:

Protein families:Inositol monophosphatase superfamily


   💬 WhatsApp