KHD1A_MOUSE   Q3UWR2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UWR2

Recommended name:KH homology domain-containing protein 1A

EC number:

Alternative names:(Nur77 downstream gene 1 protein)

Cleaved into:

GeneID:368204

Gene names  (primary ):Khdc1a

Gene names  (synonym ):Ndg1

Gene names  (ORF ):

Length:166

Mass:19690

Sequence:MSDLRRKGWWNVPDYFHSPLVFDMEEDKEDYIFGPHDEYLHTLEVHSNTLIQLERWFTPTGQTRVTVVGPLKARLWVMDMIRKVGSKNNLDQIKGKMMLLQIRDHPLRDRDLELHPESGSSLWITTMNDTTFVEVPHFLRFPLTVAWLFCGFVRILGIHNFADLHW

Tissue specificity:

Induction:By NR4A1/NUR77. {ECO:0000269|PubMed:14657025}.

Developmental stage:

Protein families:KHDC1 family


   💬 WhatsApp