SRGN_MOUSE P13609
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13609
Recommended name:Serglycin
EC number:
Alternative names:(Mastocytoma proteoglycan core protein) (Secretory granule proteoglycan core protein) (gp600)
Cleaved into:
GeneID:19073
Gene names (primary ):Srgn
Gene names (synonym ):Prg Prg1
Gene names (ORF ):
Length:152
Mass:16711
Sequence:MQVPVGSRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESNNIGPPMNNPVLMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII
Tissue specificity:
Induction:By phorbol myristate acetate in T-lymphocytes. This induction is not inhibited by cyclosporine. {ECO:0000269|PubMed:8502243}.
Developmental stage:
Protein families:Serglycin family