PTGES_MOUSE   Q9JM51


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JM51

Recommended name:Prostaglandin E synthase

EC number:EC 5.3.99.3

Alternative names:(mPGES-1) (Glutathione peroxidase PTGES) (Glutathione transferase PTGES) (Microsomal prostaglandin E synthase 1)

Cleaved into:

GeneID:64292

Gene names  (primary ):Ptges

Gene names  (synonym ):Pges

Gene names  (ORF ):

Length:153

Mass:17286

Sequence:MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

Tissue specificity:

Induction:Induced by proinflammatory stimuli and down-regulated by anti-inflammatory glucocorticoid. {ECO:0000269|PubMed:10869354, ECO:0000269|PubMed:11795891}.

Developmental stage:

Protein families:MAPEG family


   💬 WhatsApp