PDCL2_MOUSE Q78Y63
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q78Y63
Recommended name：Phosducin-like protein 2
EC number：
Alternative names：(MgcPhLP) (Phosducin-like protein similar 1)
Cleaved into：
GeneID：79455
Gene names (primary )：Pdcl2
Gene names (synonym )：
Gene names (ORF )：
Length：240
Mass：27770
Sequence：MQDPNEDTEWNEILRNFGILPPKEEPKDEIEEMVLRLQQEAMVKPYEKMTLAQLKEAEDEFDEEDIKAIEIYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVPMCLVVNQHLSVLARKFPETKFVKAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLSEVGAIQSDLEENPKKGIADMMVSSIRNISIYDSDSSGSDTEAK
Tissue specificity：Predominantly, if not exclusively, expressed in male and female germ cells. In the male germ cells, expressed from the meiotic to the late haploid stages of spermatogenesis and in the mature spermatozoa of epididymal sperm (at protein level). Also detected in fertilized eggs (at protein level). {ECO:0000269|PubMed:12424248}.
Induction：Up-regulated at the protein level as early as 3 hours after chorionic gonadotropin treatment in the ovary. {ECO:0000269|PubMed:12424248}.
Developmental stage：
Protein families：Phosducin family