CNR1_MOUSE P47746
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47746
Recommended name:Cannabinoid receptor 1
EC number:
Alternative names:(CB-R) (CB1) (Brain-type cannabinoid receptor)
Cleaved into:
GeneID:12801
Gene names (primary ):Cnr1
Gene names (synonym ):
Gene names (ORF ):
Length:473
Mass:52831
Sequence:MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Tissue specificity:Expressed in brain neurons (at protein level) (PubMed:22388959). Detected throughout the striatum, cortex and hippocampus, with highest levels in the lateral striatum (PubMed:15606779, PubMed:10891614, PubMed:22388959). In rostral brain regions, high expression levels in the dorsal lateral striatum, while in the caudal brain regions, high levels are observed in the ventral lateral striatum (PubMed:10891614). Expressed in neurons (PubMed:10891614). In the hypothalamus, expressed in both GABAergic and glutamatergic presynaptic terminals of POMC neurons (at protein level) (PubMed:25869131, PubMed:25707796). Expressed in striated muscles, including skeletal muscles (gastrocnemius and rectus abdominis) and myocardium (at protein level) (PubMed:26671069, PubMed:27826249). Expressed in the liver, with highest levels in Kupffer cells and lower levels in endothelial cells as well as hepatocytes, particularly in perivascular areas (at protein level) (PubMed:15864349, PubMed:21987372). The hepatic expression level is up-regulated in obese mice compared to lean animals (PubMed:21987372). {ECO:0000269|PubMed:10891614, ECO:0000269|PubMed:15606779, ECO:0000269|PubMed:15864349, ECO:0000269|PubMed:21987372, ECO:0000269|PubMed:22388959, ECO:0000269|PubMed:25707796, ECO:0000269|PubMed:25869131, ECO:0000269|PubMed:26671069, ECO:0000269|PubMed:27826249}.
Induction:Up-regulated by endocannabinoid anandamide/AEA (PubMed:21987372, PubMed:23955712). Down-regulated by IL1B (PubMed:23955712). Up-regulated in the liver of animals on a high-fat diet compared to regular diet (PubMed:15864349, PubMed:21987372). {ECO:0000269|PubMed:15864349, ECO:0000269|PubMed:21987372, ECO:0000269|PubMed:23955712}.
Developmental stage:
Protein families:G-protein coupled receptor 1 family