JTB_MOUSE O88824
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88824
Recommended name：Protein JTB
EC number：
Alternative names：
Cleaved into：
GeneID：23922
Gene names (primary )：Jtb
Gene names (synonym )：Gm622
Gene names (ORF )：
Length：146
Mass：16329
Sequence：MLAGAGRRGLPRAGHLCWLLCAFTLKLCEAEAPVREEKLSVSTSTSPCWLAEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGVVVAVALVFACLVIVRQRQLDRKALEKVRKQIESI
Tissue specificity：
Induction：Up-regulated by TGFB1 in mammary epithelial cells. {ECO:0000269|PubMed:17369841}.
Developmental stage：
Protein families：JTB family