MYMX_MOUSE Q2Q5T5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2Q5T5
Recommended name：Protein myomixer
EC number：
Alternative names：(Embryonic stem cell- and germ cell-specific protein) (ESGP) (Microprotein inducer of fusion) (Protein minion) (Protein myomerger)
Cleaved into：
GeneID：653016
Gene names (primary )：Mymx
Gene names (synonym )：Gm7325
Gene names (ORF )：
Length：84
Mass：9598
Sequence：MPVPLLPMVLRSLLSRLLLPVARLARQHLLPLLRRLARRLSSQDMREALLSCLLFVLSQQQPPDSGEASRVDHSQRKERLGPQK
Tissue specificity：Specifically expressed in developing skeletal muscles throughout the limbs and body wall (PubMed:28569745, PubMed:28569755, PubMed:28386024). {ECO:0000269|PubMed:28386024, ECO:0000269|PubMed:28569745, ECO:0000269|PubMed:28569755}.
Induction：Up-regulated during differentiation of myoblasts (PubMed:28569745, PubMed:28569755, PubMed:28386024). During muscle regeneration (PubMed:28569745, PubMed:28569755, PubMed:28386024). {ECO:0000269|PubMed:28386024, ECO:0000269|PubMed:28569745, ECO:0000269|PubMed:28569755}.
Developmental stage：
Protein families：MYMX family