ST1D1_MOUSE Q3UZZ6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UZZ6
Recommended name：Sulfotransferase 1 family member D1
EC number：EC 2.8.2.-
Alternative names：(ST1D1) (Amine N-sulfotransferase) (SULT-N) (Dopamine sulfotransferase Sult1d1) (Tyrosine-ester sulfotransferase)
Cleaved into：
GeneID：53315
Gene names (primary )：Sult1d1
Gene names (synonym )：St1d1
Gene names (ORF )：
Length：295
Mass：35083
Sequence：MDNKLDVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRSEI
Tissue specificity：Detected in kidney and liver. Detected in kidney collecting duct cells. {ECO:0000269|PubMed:19966186, ECO:0000269|PubMed:9647753}.
Induction：Up-regulated in liver and kidney by dexamethasone, a glucocorticoid analog. {ECO:0000269|PubMed:19966186}.
Developmental stage：
Protein families：Sulfotransferase 1 family