PSA6_MOUSE Q9QUM9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QUM9
Recommended name：Proteasome subunit alpha type-6
EC number：
Alternative names：(Macropain iota chain) (Multicatalytic endopeptidase complex iota chain) (Proteasome iota chain)
Cleaved into：
GeneID：26443
Gene names (primary )：Psma6
Gene names (synonym )：
Gene names (ORF )：
Length：246
Mass：27372
Sequence：MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
Tissue specificity：Detected in liver (at protein level). {ECO:0000269|PubMed:22341445}.
Induction：Up-regulated in liver tumor tissues (at protein level). {ECO:0000269|PubMed:16317774}.
Developmental stage：
Protein families：Peptidase T1A family