MTNB_MOUSE   Q9WVQ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WVQ5

Recommended name:Methylthioribulose-1-phosphate dehydratase

EC number:EC 4.2.1.109

Alternative names:(MTRu-1-P dehydratase) (APAF1-interacting protein) (Monocyte/macrophage protein 19)

Cleaved into:

GeneID:56369

Gene names  (primary ):Apip

Gene names  (synonym ):Mmrp19

Gene names  (ORF ):

Length:241

Mass:26949

Sequence:MSGCQAQGDCCSRPCGAQDKEHPRFLIPELCKQFYHLGWVTGTGGGISLKHGNEIYIAPSGVQKERIQPEDMFVCDINEQDISGPPASKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGQEFKITHQEMIKGIRKCTSGGYYRYDDMLVVPIIENTPEEKDLKERMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIAVSMKKMGLDPTQLPVGENGIV

Tissue specificity:Expressed in skeletal muscle (at protein level). {ECO:0000269|PubMed:15262985}.

Induction:Up-regulated upon ischemia/hypoxia. {ECO:0000269|PubMed:15262985}.

Developmental stage:

Protein families:Aldolase class II family, MtnB subfamily


   💬 WhatsApp