SYT11_MOUSE Q9R0N3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0N3
Recommended name：Synaptotagmin-11
EC number：
Alternative names：(Synaptotagmin XI) (SytXI)
Cleaved into：
GeneID：229521
Gene names (primary )：Syt11
Gene names (synonym )：
Gene names (ORF )：
Length：430
Mass：48333
Sequence：MAEITNIRPSFDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPRRESGRGNLLINAESGLLSHDKDPRGPSPASCMDQLPIKRDYGEELRSPMTSLTPGESKATSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKPIAKWHSLSEY
Tissue specificity：Expressed in cerebellun, cerebellar cortex, hippocampus, olfactory bulb and spinal cord (at protein level) (PubMed:30808661). Expressed by neurons, astrocytes and microglia (at protein level) (PubMed:28686317, PubMed:26450452). Expressed in macrophages (at protein level) (PubMed:23303671). {ECO:0000269|PubMed:23303671, ECO:0000269|PubMed:26450452, ECO:0000269|PubMed:28686317, ECO:0000269|PubMed:30808661}.
Induction：
Developmental stage：Abundant across the brain, expression increases progressively over the first 2 weeks after birth. {ECO:0000269|PubMed:30808661}.
Protein families：Synaptotagmin family