UTER_MOUSE Q06318
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06318
Recommended name：Uteroglobin
EC number：
Alternative names：(Clara cell 17 kDa protein) (Clara cell phospholipid-binding protein) (CCPBP) (Clara cells 10 kDa secretory protein) (CC10) (PCB-binding protein) (Secretoglobin family 1A member 1)
Cleaved into：
GeneID：22287
Gene names (primary )：Scgb1a1
Gene names (synonym )：Cc10 Ugb Utg
Gene names (ORF )：
Length：96
Mass：10519
Sequence：MKIAITITVVMLSICCSSASSDICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF
Tissue specificity：Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).
Induction：By glucocorticoids.
Developmental stage：Appears on the eighteenth day of gestation in the airway epithelium.
Protein families：Secretoglobin family