SSU72_MOUSE Q9CY97
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CY97
Recommended name：RNA polymerase II subunit A C-terminal domain phosphatase SSU72
EC number：EC 3.1.3.16
Alternative names：(CTD phosphatase SSU72) (EC 3.1.3.16)
Cleaved into：
GeneID：68991
Gene names (primary )：Ssu72
Gene names (synonym )：
Gene names (ORF )：
Length：194
Mass：22517
Sequence：MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRAFLHTVCFY
Tissue specificity：Highly expressed in the brain. Expressed at low level in most tissues. {ECO:0000269|PubMed:15659578}.
Induction：
Developmental stage：At 10.5 dpc, low level expression detected throughout the embryo with relative accumulation in spinal cord and brain folds. At 13.5 dpc, highly expressed in the CNS both in the ventricular (mitotic) and marginal (post mitotic) zones, in the PNS in dorsal root and trigeminal ganglia, and the developing gut. During development, expression in the central nervous system and peripheral nervous system persists, and expression in the intestine is further induced. Expression in the intestine is observed throughout the mucosal villi, which contains epithelial cells and other cell types. High expression is also detected in the lens. No expression is seen in other tissues such as liver, lung, bone, cardiac and skeletal muscles. {ECO:0000269|PubMed:15659578}.
Protein families：SSU72 phosphatase family