CRX_MOUSE   O54751


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54751

Recommended name:Cone-rod homeobox protein

EC number:

Alternative names:

Cleaved into:

GeneID:12951

Gene names  (primary ):Crx

Gene names  (synonym ):

Gene names  (ORF ):

Length:299

Mass:32374

Sequence:MMAYMNPGPHYSVNALALSGPNVDLMHQAVPYSSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQQQPPGAQTKARPAKRKAGTSPRPSTDVCTDPLGISDSYSPSLPGPSGSPTTAVATVSIWSPASEAPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYASPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYSTYSPVDSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL

Tissue specificity:Retina. {ECO:0000269|PubMed:16574740}.

Induction:

Developmental stage:At 17.5 dpc, expressed in a narrow zone in the peripheral outer nuclear layer of the retina. At P12, expressed over the entire photoreceptor layer. {ECO:0000269|PubMed:16574740}.

Protein families:Paired homeobox family


   💬 WhatsApp