MLRV_MOUSE P51667
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51667
Recommended name：Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
EC number：
Alternative names：(MLC-2) (MLC-2v) (Myosin light chain 2, slow skeletal/ventricular muscle isoform) (MLC-2s/v)
Cleaved into：
GeneID：17906
Gene names (primary )：Myl2
Gene names (synonym )：Mylpc
Gene names (ORF )：
Length：166
Mass：18864
Sequence：MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Tissue specificity：Abundantly expressed in both cardiac and slow skeletal muscle (PubMed:1379240). In the adult heart, the phosphorylated form is highly expressed in epicardium and weakly in endocardium (PubMed:22426213). {ECO:0000269|PubMed:1379240, ECO:0000269|PubMed:22426213}.
Induction：
Developmental stage：At 8 dpc highly expressed in the ventricular portion of the heart tube, with no detectable expression in the atrial or sinus venosus regions; also expressed in the proximal outflow tract of the heart tube at minimally detectable levels. At 9-10 dpc expression is well established in the proximal outflow tract region adjacent to the ventricular segment. At 11 dpc, expression becomes restricted to the ventricular region. {ECO:0000269|PubMed:8506363}.
Protein families：