YPEL1_MOUSE Q9ESC7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ESC7
Recommended name:Protein yippee-like 1
EC number:
Alternative names:(DGL-1) (Mdgl-1)
Cleaved into:
GeneID:106369
Gene names (primary ):Ypel1
Gene names (synonym ):
Gene names (ORF ):
Length:118
Mass:13468
Sequence:MVKMTKSKTFQAYLPHCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGW
Tissue specificity:
Induction:
Developmental stage:At 9.5 dpc, expressed throughout the ventral mesoderm of the trunk and head. At 10.5 dpc, maintained in the ventral aspect of the axial tissues; detected in the branchial clefts, branchial arches, in the heart and in the cranial mesenchyme underlying the mid-brain. No expression in the dorsal part of the embryo, in the somatopleure nor in the splanchnopleure. At 11.0 dpc, expressed in the branchial arches in the mesenchyme underlying the ectoderm, but not the endoderm. {ECO:0000269|PubMed:11473580}.
Protein families:Yippee family