ARRC_MOUSE Q9EQP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQP6
Recommended name：Arrestin-C
EC number：
Alternative names：(Cone arrestin) (cArr) (Retinal cone arrestin-3)
Cleaved into：
GeneID：170735
Gene names (primary )：Arr3
Gene names (synonym )：
Gene names (ORF )：
Length：381
Mass：41921
Sequence：MSTVFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVVLVDPEYLEGRKLFVRLTCAFRYGRDDLDVIGLTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPEDSGKPCGVDFEVKSFCAENLEEKIPKSDSVQLVVRKVQFSALEPGPGPSAQTIRSFFLSSQPLQLQAWMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVVQTTDVVLYSLDKYTKTVFVQEFTETVAANSSFSQTFAVTPLLAANCQKQGLALDGKLKHEDTNLASSTILRPGMNKELLGILVSYKVRVNLVVSYGGILGGLPASDVGVELPVILIHPKPSPGERAVATSSEDIVIEEFMQHNSQTQS
Tissue specificity：Inner and outer segments, and the inner plexiform regions of the retina.
Induction：
Developmental stage：At postnatal day 11 (P11) expressed in the soma and photoreceptor processes of the retinal inner segment, outer segment, outer plexiform layer, and inner plexiform layer. Expression in the inner plexiform layer is lost at P22. {ECO:0000269|PubMed:28151698}.
Protein families：Arrestin family