DAZP2_MOUSE Q9DCP9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DCP9
Recommended name：DAZ-associated protein 2
EC number：
Alternative names：(Deleted in azoospermia-associated protein 2) (Proline-rich protein expressed in brain)
Cleaved into：
GeneID：23994
Gene names (primary )：Dazap2
Gene names (synonym )：Prtb
Gene names (ORF )：
Length：168
Mass：17289
Sequence：MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSAVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Tissue specificity：Widely expressed. Highly expressed in brain. {ECO:0000269|PubMed:10373015, ECO:0000269|PubMed:14530442}.
Induction：By serum stimulation. {ECO:0000269|PubMed:11787059}.
Developmental stage：Between 11.5 dpc and 12.5 dpc it is specifically expressed in the developing heart. From 13.5 dpc, expression in the heart disappears, while it become strongly expressed in the brain. Up-regulated during adhesion and differentiation to beating cardiomyocytes. {ECO:0000269|PubMed:10373015}.
Protein families：