NICN1_MOUSE   Q9CQM0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQM0

Recommended name:Nicolin-1

EC number:

Alternative names:(Tubulin polyglutamylase complex subunit 5) (PGs5) (p24)

Cleaved into:

GeneID:66257

Gene names  (primary ):Nicn1

Gene names  (synonym ):

Gene names  (ORF ):

Length:213

Mass:24360

Sequence:MSRVLVPCHVKSTVALQVGDMRTSQGRPGVLVVDVTFPNIAPFELQEIMFKNYYTAFLSIRVRQQSSMHTAAKWVTCLRDYCLMPDPHSEEGAQDYVSLFKHQMLCDMNRVLELRLILRQPSPLWLSFTVEELQIYQQGPKSPSLAFPKWLSHPVSNEQPAPRLEGLPDPSRVSSEVQQMWALTEMIRASHTSTRIGRFDVDGCYDLNLLSYT

Tissue specificity:High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestin and colon. {ECO:0000269|PubMed:12392556}.

Induction:

Developmental stage:Detected in all tissues of the developing embryos. {ECO:0000269|PubMed:12392556}.

Protein families:


   💬 WhatsApp