TLX2_MOUSE Q61663
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61663
Recommended name：T-cell leukemia homeobox protein 2
EC number：
Alternative names：(Enteric neuron homeobox protein) (Homeobox TLX-2) (Homeobox protein Hox-11L1) (Hox11L.1) (PMUR10F)
Cleaved into：
GeneID：21909
Gene names (primary )：Tlx2
Gene names (synonym )：Enx Hox11l1 Ncx Tlx1l1
Gene names (ORF )：
Length：284
Mass：30361
Sequence：MEPAVLAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAGSLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV
Tissue specificity：
Induction：
Developmental stage：Detected in cranial ganglia at 9 dpc, and in dorsal root ganglia by 10.5 dpc. First detected in gut at 11.5 dpc, with a marked increase by 12.5 dpc. After birth, detected in myenteric and submucosal neurons innervating the distal ileum, colon and rectum. {ECO:0000269|PubMed:9176491}.
Protein families：