XLR5C_MOUSE Q9JJR2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJR2
Recommended name：X-linked lymphocyte-regulated protein 5C
EC number：
Alternative names：
Cleaved into：
GeneID：27084
Gene names (primary )：Xlr5c
Gene names (synonym )：Xlr5
Gene names (ORF )：
Length：179
Mass：20702
Sequence：MSNKEQKDMKKSGKHQRVHKTLPSDDFKNSDAVNPADKPAVGTSGMGSHSSGSDMQEAREPVQKKMQDFKGDDGTGLLMEKRKQFEEDVNASFRSLNENLQSILKAQQNSRQELKSLYCERFGSVYHNWLVEMDRTRDQEEYFSFITQQQMKILQTAIEDHETKLKNAKDMCDTFLKVW
Tissue specificity：Expressed in testis (at protein level). Also expressed in ovary. Not detected in other tissues tested. {ECO:0000269|PubMed:26075718}.
Induction：
Developmental stage：Detected in testis from 1 day postpartum (dpp) onwards (at protein level). Expression increases through to 28 dpp and remains high thereafter (at protein level). Highly expressed in spermatocytes at leptotene and pachytene stages of meiosis. {ECO:0000269|PubMed:26075718}.
Protein families：XLR/SYCP3 family