HIKES_MOUSE Q9DD02
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DD02
Recommended name：Protein Hikeshi
EC number：
Alternative names：(Lethal gene on chromosome 7 Rinchik 6 protein)
Cleaved into：
GeneID：67669
Gene names (primary )：Hikeshi
Gene names (synonym )：L7rn6
Gene names (ORF )：
Length：197
Mass：21619
Sequence：MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
Tissue specificity：Expressed in the central white matter of newborn and adult brain, particularly in regions where oligodendrocytes are generated (PubMed:26545878). {ECO:0000269|PubMed:26545878}.
Induction：
Developmental stage：During late gestation, it is expressed in lung epithelial cells, whereas perinatal expression is restricted to the bronchiolar epithelium. {ECO:0000269|PubMed:16157679}.
Protein families：OPI10 family