CRIS1_MOUSE Q03401
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q03401
Recommended name：Cysteine-rich secretory protein 1
EC number：
Alternative names：(CRISP-1) (Acidic epididymal glycoprotein 1) (Sperm-coating glycoprotein 1) (SCP 1)
Cleaved into：
GeneID：11571
Gene names (primary )：Crisp1
Gene names (synonym )：Aeg-1 Aeg1
Gene names (ORF )：
Length：244
Mass：27680
Sequence：MALMLVLFFLAAVLPPSLLQDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH
Tissue specificity：Mainly found in the cauda epididymis where it is synthesized by the principal cells and secreted into the lumen. Binds to the heads of spermatozoa. Also expressed in the submandibular gland.
Induction：By androgens.
Developmental stage：Exponential increase between days 25 and 30 after birth.
Protein families：CRISP family