YAF2_MOUSE Q99LW6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99LW6
Recommended name：YY1-associated factor 2
EC number：
Alternative names：
Cleaved into：
GeneID：67057
Gene names (primary )：Yaf2
Gene names (synonym )：
Gene names (ORF )：
Length：179
Mass：19655
Sequence：MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDRVEKDKSEKEAASKKNCHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGEASSLNGESH
Tissue specificity：In the mesoderm, expressed in the region close to the surface ectoderm. {ECO:0000269|PubMed:14557078}.
Induction：
Developmental stage：Expressed in both pre- and post-implantation embryos. {ECO:0000269|PubMed:14557078}.
Protein families：