LAMP5_MOUSE Q9D387
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D387
Recommended name：Lysosome-associated membrane glycoprotein 5
EC number：
Alternative names：(Brain and dendritic cell-associated LAMP) (Brain-associated LAMP-like protein) (BAD-LAMP) (Lysosome-associated membrane protein 5) (LAMP-5)
Cleaved into：
GeneID：76161
Gene names (primary )：Lamp5
Gene names (synonym )：
Gene names (ORF )：
Length：280
Mass：31721
Sequence：MDLRVRTLLGGDRLRILLMFFHVMVQTVAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEETLPLILGLILGLVIVITLVIYHIHHKMTANQVQIPRDRSQYKHMG
Tissue specificity：In brain, strongly expressed in the globus pallidus/ventral pallidum complex, the substantia nigra pars reticulata and the entopeduncular nucleus (at protein level) (PubMed:27272053). Expressed in the external plexiform layer of the olfactory bulb (at protein level). May be weakly expressed in neocortex and striatum (at protein level) (PubMed:27272053). Highly expressed in brain; not detected in other tissues tested (PubMed:17215451). Detected in the cingulate cortex, cortical plate and caudate putamen (PubMed:17215451). In neocortex, specifically expressed in neurons of layers II/III and V (PubMed:17215451). {ECO:0000269|PubMed:17215451, ECO:0000269|PubMed:27272053}.
Induction：
Developmental stage：Expressed in embryo at 14 dpc. {ECO:0000269|PubMed:17215451}.
Protein families：LAMP family