PLD6_MOUSE Q5SWZ9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5SWZ9
Recommended name：Mitochondrial cardiolipin hydrolase
EC number：EC 3.1.-.-
Alternative names：(Choline phosphatase 6) (Mitochondrial phospholipase) (MitoPLD) (Phosphatidylcholine-hydrolyzing phospholipase D6) (Phospholipase D6) (PLD 6) (Protein zucchini homolog) (mZuc)
Cleaved into：
GeneID：194908
Gene names (primary )：Pld6
Gene names (synonym )：
Gene names (ORF )：
Length：221
Mass：25041
Sequence：MGRSSWRLVFAAGAGLALALEALPWLMRWLLAGRRPRREVLFFPSQVTCTEALLQAPGLPPGPSGCPCSLPHSESSLSRLLRALLAARSSLELCLFAFSSPQLGRAVQLLHQRGVRVRVITDCDYMALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVDKKVLITGSLNWTTQAIQNNRENVLIMEDTEYVRLFLEEFERIWEEFDPTKYSFFPQKHRGH
Tissue specificity：Predominantly expressed in testis (at protein level). Also expressed at high levels in growing ovary. {ECO:0000269|PubMed:21397847}.
Induction：
Developmental stage：Expressed in embryonic testis at 16.5 dpc (at protein level). Expressed at low levels in type A and B spermatogonia, increases 5-fold in spermatocytes undergoing meiosis (pachytene spermatocytes), and then decreases again in round spermatids. Expressed at low levels in testes in young mice, peaks from postnatal day 14 to day 29 with the onset of puberty andpersists in adulthood (at protein level). {ECO:0000269|PubMed:21397847, ECO:0000269|PubMed:21397848}.
Protein families：Phospholipase D family, MitoPLD/Zucchini subfamily