CBX2_MOUSE P30658
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30658
Recommended name：Chromobox protein homolog 2
EC number：
Alternative names：(M33) (Modifier 3 protein)
Cleaved into：
GeneID：12416
Gene names (primary )：Cbx2
Gene names (synonym )：M33
Gene names (ORF )：
Length：519
Mass：54918
Sequence：MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKHTVTSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEDDSDLDSKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKAARRPVSLAKVLKTTRKDLGTSAAKLPPPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKAQATNKCGLGLDLKVRTQKGGELGGSPAGGKVPKAPGGGAAEQQRGNHSGSPGAQLAPTQELSLQVLDLQSVKNGVPGVGLLARHAPAKAIPATNPATGKGPGSGPTGANMTNAPTDNNKGEKLTCKATALPAPSVKRDTVKSVAASGGQEGHTAPGEGRKPPALSELSTGEENSSSDSDPDSTSLPSAAQNLSVAIQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY
Tissue specificity：Expressed in embryoid bodies. {ECO:0000269|PubMed:22226355}.
Induction：
Developmental stage：Expressed in most embryonic tissues except the heart from 8.5 to 11.5 dpc. Expressed in central nervous system (CNS, ventricular zone and spinal cord), peripheral nervous system (PNS, sensory cranial and spinal ganglia), olfactory and tongue epithelia, lung, gastrointestinal duct and urogenital system at 13.5 dpc. Expressed in CNS, thymus, various epithelial cell types including the olfactory, tooth and tongue epithelia at 15.5 dpc. {ECO:0000269|PubMed:9312051}.
Protein families：