RCAS1_MOUSE Q9D0V7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D0V7
Recommended name：Receptor-binding cancer antigen expressed on SiSo cells
EC number：
Alternative names：(Cancer-associated surface antigen RCAS1) (Estrogen receptor-binding fragment-associated gene 9 protein)
Cleaved into：
GeneID：55960
Gene names (primary )：Ebag9
Gene names (synonym )：Rcas1
Gene names (ORF )：
Length：213
Mass：24319
Sequence：MAITQFRLFKVCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGVPDGSTGFSSRLAATQDMPFIHQSSELGDLDTWQENSNAWEEEEDAAWQAEEVLRQQKIADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Tissue specificity：Widely expressed. Expressed in heart, brain, spleen, liver, kidney and testis. {ECO:0000269|PubMed:11374862}.
Induction：By 17-beta-estradiol (E2). {ECO:0000269|PubMed:11374862}.
Developmental stage：Expressed in the developing embryo. {ECO:0000269|PubMed:11374862}.
Protein families：