SYNB_MOUSE Q8BI41
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BI41
Recommended name：Syncytin-B [Cleaved into: Surface protein
EC number：
Alternative names：(SU); Transmembrane protein (TM)]
Cleaved into：
GeneID：239167
Gene names (primary )：Synb
Gene names (synonym )：
Gene names (ORF )：
Length：618
Mass：69514
Sequence：MTGFWVLCFVLFPSSLSYPESWMPLVNLTHHILRDTNSSLFSNCWVCLSTQTQRSLAVPAPLSIWTDTPMKLHLTYSVRPFSGSFSISDIERRLRLFRPLTASYSFHNPDRRAIAFLQLVSSTGIFRIITRITSVIYPHKDRFFESAQRPLWGPLFTETVLRSQAPLCISRFFKVSAYATFVGNLSASLCNYTMHISPSTSHENLDLSTTHTFKQAMKRPDAKWKNPLRFSGPPSLIFSKPAYYPCPTDIKHCHTSPATPWMHCPQAPFGTCYNLTLFEPDNSTHPVTMSVNPTHFKVKLQGHRDPYPLSHYQPLTGAALSGQYSVWENEITVQENWDITSNIFSHLLSFSYAFCLNSSGVFFLCGTSTYICLPANWSGVCTLVFQYPDIELLPNNQTVPVPLFASVLSSDSVLRPKRSPHLFPFLAGLGISSALGTGIAGLATSTLYFQQLSKVLSETLEEIAASITTLQNQIDSLAGVVLQNRRALDLITAEKGGTCLFLQEECCFYVNQSGIVRDAARKLQERASELGQHSDSWGQWPDLGRWLPWLTPFLGPLLFLFFLLTFGSCLLNCLTRFVSQRLGSFVQDTAKRHVDSILQNFQYKKLPQDSPDEDTIPT
Tissue specificity：Highly expressed in placenta where it localizes to syncytiotrophoblasts of the labyrinthine zona (PubMed:15644441). Specifically localizes to syncytiotrophoblast layer II (SynT-II) (PubMed:18448564). Also detected at very low levels in ovary (PubMed:15644441). {ECO:0000269|PubMed:15644441, ECO:0000269|PubMed:18448564}.
Induction：In males, up-regulated in regenerating muscle tissue after injury. {ECO:0000269|PubMed:27589388}.
Developmental stage：Expressed in the placental labyrinth from stage 8.5 dpc onwards. {ECO:0000269|PubMed:18448564}.
Protein families：Gamma type-C retroviral envelope protein family