NEUL1_MOUSE   Q923S6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q923S6

Recommended name:E3 ubiquitin-protein ligase NEURL1

EC number:EC 2.3.2.27

Alternative names:(Neuralized-like protein 1A) (m-neu1) (m-neuralized 1) (Neuralized1) (RING-type E3 ubiquitin transferase NEURL1)

Cleaved into:

GeneID:18011

Gene names  (primary ):Neurl1

Gene names  (synonym ):Neurl Neurl1a

Gene names  (ORF ):

Length:574

Mass:61778

Sequence:MGNNFSSVSSLQRGNPSRASRGHPQNLKDSIGGSFPVPSHRCHHKQKHCPPTLSGGGLPATPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFYRINESAAMLFFSGVRTVDPLWALVDVYGLTRGVQLLDSELVLPDCLRPRSFTALRRPSLRCEADEARLSVSLCDLNVPGADGDDGAPPAGCPIPQNSLNSQHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARLEHGRDERALVFTSRPVRVAETIFIKVTRSGGGRAGALSFGVTTCDPGTLRPADLPFSPEALVDRKEFWAVCRVPGPLHSGDILGLVVNADGELHLSHNGAAAGMQLCVDASQPLWMLFSLHGAITQVRILGSTIMTERGGPSLPCSPASTPTSPSALGIRLSDPLLSTCGSGPLGGSAGGTAPNSPVSLPESPVTPGLGQWSDECTICYEHAVDTVIYTCGHMCLCYSCGLRLKKALHACCPICRRPIKDIIKTYRSS

Tissue specificity:Expressed in CA1 pyramidal neurons (at protein level). Expressed throughout the adult forebrain, including the cerebral cortex, amygdala, striatum, and CA1 area of the hippocampus. Expressed in sensory neurons of the olfactory epithelium, the vomeronasal organ, mammary gland and skeletal muscle. {ECO:0000269|PubMed:11481456, ECO:0000269|PubMed:11585928, ECO:0000269|PubMed:22153079}.

Induction:Up-regulated by synaptic activity. {ECO:0000269|PubMed:22153079}.

Developmental stage:Expressed in the somites at 8.5 dpc onwards. {ECO:0000269|PubMed:11481456, ECO:0000269|PubMed:11585928}.

Protein families:


   💬 WhatsApp