EDN1_MOUSE P22387
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22387
Recommended name：Endothelin-1
EC number：
Alternative names：(ET-1) (Preproendothelin-1) (PPET1)
Cleaved into：Big endothelin-1
GeneID：13614
Gene names (primary )：Edn1
Gene names (synonym )：
Gene names (ORF )：
Length：202
Mass：22809
Sequence：MDYFPVIFSLLFVTFQGAPETAVLGAELSTGAENGVQSPPPSTPWRPRRSKRCSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGGSSRSKRSLKDLLPNKATDQAVRCQCAHQKDKKCWNFCQAGKELRAQSTMQKSLKDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIKASFRVAKLKAELYRDQKLTHNRAH
Tissue specificity：Highest expression in the adult is in lung. Lower levels found in heart, kidney, brain and intestine. In the embryo, expressed in outer and inner pharyngeal arch surfaces. Also expressed in endothelium of dorsal aorta and arch arteries, and in epithelium of pharyngeal pouches. {ECO:0000269|PubMed:8824799}.
Induction：
Developmental stage：Expression in lung is low at 17.5 dpc fetal mice and increases progressively into adulthood. {ECO:0000269|PubMed:8824799}.
Protein families：Endothelin/sarafotoxin family