SELW_MOUSE   P63300


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63300

Recommended name:Selenoprotein W

EC number:

Alternative names:(SelW)

Cleaved into:

GeneID:20364

Gene names  (primary ):Selenow

Gene names  (synonym ):Selw Sepw1

Gene names  (ORF ):

Length:88

Mass:9687

Sequence:MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQCQ

Tissue specificity:In the embryo, expressed in the developing nervous system and in mesoderm-derived tissues such as heart and limbs. In the adult, predominantly expressed in brain, skeletal muscle and heart. {ECO:0000269|PubMed:16876868, ECO:0000269|PubMed:17503775}.

Induction:Down-regulated by hydrogen peroxide. Increased levels are detected after treatment with L-buthionine sulfoxide (BSO) before exposure to hydrogen peroxide. {ECO:0000269|PubMed:16876868}.

Developmental stage:Expression is first detected in the newly implanted embryo. Levels increase gradually during embryonic development with a steady increase during the second week and a dramatic increase by the end of gestation. Expression increases gradually in proliferating myotubes but is low in terminally differentiated myobutubes. {ECO:0000269|PubMed:16876868}.

Protein families:SelWTH family, Selenoprotein W subfamily


   💬 WhatsApp