PR8A9_MOUSE   Q9CQ58


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ58

Recommended name:Prolactin-8A9

EC number:

Alternative names:(Placental prolactin-like protein C2) (PLP-C2) (PRL-like protein C2) (Prolactin-like protein C-beta) (PLP C-beta)

Cleaved into:

GeneID:67310

Gene names  (primary ):Prl8a9

Gene names  (synonym ):Prlpc2

Gene names  (ORF ):

Length:241

Mass:27697

Sequence:MVLPLSQPHFSGALLLLVVSNLLLWEKASAIPACMAQKSGCWNPLVETFNSAMQTAGTLRTLADQFYVELYHNQFSSGQFLIFNSNLIRRDETVARAGTYCHSTLSNPPDRGTEHADAETEKYLKTLINYVGAWIGPLYHVVIELNVMQDVPETILSKVRQIEENKRKLLEDLRWILTKVYPTAEMKEEFPAWEHLSFLKSQGKHYKLLAMFNLSNCIYNETYHILFYLRELKCQITGEDC

Tissue specificity:Detected only in placenta. Localized to spongiotrophoblasts and trophoblast giant cells of the placenta. {ECO:0000269|PubMed:10965907}.

Induction:

Developmental stage:First detected at 11.5 dpc and expressed continually throughout development, its expression level fluctuated during gestation. {ECO:0000269|PubMed:10965907}.

Protein families:Somatotropin/prolactin family


   💬 WhatsApp