BCAT1_MOUSE P24288
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24288
Recommended name：Branched-chain-amino-acid aminotransferase, cytosolic
EC number：EC 2.6.1.42
Alternative names：(BCAT(c)) (Protein ECA39)
Cleaved into：
GeneID：12035
Gene names (primary )：Bcat1
Gene names (synonym )：Eca39
Gene names (ORF )：
Length：386
Mass：42791
Sequence：MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP
Tissue specificity：Expressed in brain and kidney. Overexpressed in MYC-induced brain tumors, lymphomas, as well as in a teratocarcinoma cell line.
Induction：
Developmental stage：Highly expressed at day 9 of embryogenesis. Expression decreases to moderate levels through day 13. In the developing embryo, expressed in the brain, somites and mesenophric tubules.
Protein families：Class-IV pyridoxal-phosphate-dependent aminotransferase family