ZN296_MOUSE E9Q6W4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:E9Q6W4
Recommended name：Zinc finger protein 296
EC number：
Alternative names：(Hepatocellular carcinoma-associated antigen MHCA108)
Cleaved into：
GeneID：63872
Gene names (primary )：Znf296
Gene names (synonym )：Zfp296
Gene names (ORF )：
Length：445
Mass：47821
Sequence：MSRRKAGRVPRRVDPDTDTDIEMPDLVMDVKPDLDLRSLAQGPWIARDMPISDVKRQLQTASRPLGAPSTCAPRMPLSSKSSDRQPWTDKHPDLLTCGRCGKIFPLGAIIAFMDHKKQGCQLLQVSDPISESKELKALSCLQCGRQYTSPWKLLCHAQWDHGLCIYQTQHLDTPEAPLLGLAEVAAAMSAVAVVAPVESKPPPVSSAARRSPTCDVCKKTLSSFSNLKVHMRSHTGERPYSCDQCSYACAQSSKLNRHKKTHRQLAPGSPSTSASSRGVSPAAPPEPAAYAAAPASTLPSQTVEKAGAAATAGVQEPGAPGSGAQGGPGFVGWGAPAKVERTDPVKIEKTAPRKSHGPGGKCEFCGKSFTNSSNLTVHRRSHTGERPYTCDQCPYACAQSSKLNRHRRTHGLGTGKTVKCPHCLVPFGLQATLDKHLRQKHPEMA
Tissue specificity：Strongly expressed in testis and embryonic stem cells. {ECO:0000269|PubMed:11063263}.
Induction：
Developmental stage：In testis, detected in condensing spermatids but not at earlier stages of spermatogenesis (PubMed:11063263). In embryonic stem cells, expressed in undifferentiated cells and down-regulated upon differentiation (PubMed:24161396). {ECO:0000269|PubMed:11063263, ECO:0000269|PubMed:24161396}.
Protein families：Krueppel C2H2-type zinc-finger protein family