ITL1A_MOUSE O88310
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88310
Recommended name：Intelectin-1a
EC number：
Alternative names：(Galactofuranose-binding lectin) (Intestinal lactoferrin receptor)
Cleaved into：
GeneID：16429
Gene names (primary )：Itln1
Gene names (synonym )：Intl Itln Itln1a Itlna
Gene names (ORF )：
Length：313
Mass：34953
Sequence：MTQLGFLLFIMVATRGCSAAEENLDTNRWGNSFFSSLPRSCKEIKQEHTKAQDGLYFLRTKNGVIYQTFCDMTTAGGGWTLVASVHENNMRGKCTVGDRWSSQQGNRADYPEGDGNWANYNTFGSAEAATSDDYKNPGYFDIQAENLGIWHVPNKSPLHNWRKSSLLRYRTFTGFLQHLGHNLFGLYKKYPVKYGEGKCWTDNGPALPVVYDFGDARKTASYYSPSGQREFTAGYVQFRVFNNERAASALCAGVRVTGCNTEHHCIGGGGFFPEGNPVQCGDFASFDWDGYGTHNGYSSSRKITEAAVLLFYR
Tissue specificity：Expressed in small intestinal Paneth cells in uninfected mice. Expression also detected in various other tissues including stomach, kidney, ovary and brain. {ECO:0000269|PubMed:15222482, ECO:0000269|PubMed:15265922, ECO:0000269|PubMed:16866365, ECO:0000269|PubMed:16936804, ECO:0000269|PubMed:9790983}.
Induction：By infection with the helminth parasite N.brasiliensis. {ECO:0000269|PubMed:17420014}.
Developmental stage：In the embryo, levels are highest at day 7, decrease by mid-embryogenesis at day 11 and increase again in late embryogenesis at day 17. {ECO:0000269|PubMed:15222482}.
Protein families：