ELF5_MOUSE Q8VDK3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VDK3
Recommended name:ETS-related transcription factor Elf-5
EC number:
Alternative names:(E74-like factor 5)
Cleaved into:
GeneID:13711
Gene names (primary ):Elf5
Gene names (synonym ):
Gene names (ORF ):
Length:253
Mass:29873
Sequence:MLDSVTHSTFLPNASFCDPLMPWTDLFSNEDYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDANCISFCHFNISGLQLCSMTQEEFIEAAGICGEYLYFILQNIRSQGYSFFNDAEETKTGIKDYADSSCLKTSGIKSQDCHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEEKL
Tissue specificity:Expressed in lung, kidney, stomach, brain, ovaries, tongue, bladder and mammary glands. {ECO:0000269|PubMed:9840936}.
Induction:
Developmental stage:In the neonatal stage, and during embryogenesis on days 16, 17 and 19, an expression pattern similar to the adult was observed. In addition at stage 16, expression was detected in small intestine.
Protein families:ETS family