NR2C1_MOUSE Q505F1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q505F1
Recommended name:Nuclear receptor subfamily 2 group C member 1
EC number:
Alternative names:(Orphan nuclear receptor TR2) (Testicular receptor 2) (mTR2)
Cleaved into:
GeneID:22025
Gene names (primary ):Nr2c1
Gene names (synonym ):Tr2 Tr2-11
Gene names (ORF ):
Length:590
Mass:65476
Sequence:MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSGMFVNIHPSGIKTEPAMLMAPDKAESCQGDLSTLASVVTSLANLGKAKDLSHCGGDMPVVQSLRNGDTSFGAFHHDIQTNGDVSRAFDTLAKALTPGESSACQSPEEGMEGSPHLIAGEPSFVEKEGPLLSESHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSPERRKSLMEHIFKLQEFCNSMVKLCIDGHEYAYLKAIVLFSPDHPGLENMELIERFQEKAYVEFQDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL
Tissue specificity:Isoform 1 is highly expressed in the adlumenal compartment of the seminiferous tubule of adult testes (at protein level) and in the eyes of newborn animals. Weakly expressed in other adult organs including the seminal vesicle, prostate, ovary, adrenal gland, heart, thymus, placenta and brain. Expressed during embryonic stages in developing eyes, brain and cartilage primordia (at protein level). Also expressed in the developing spinal motor neurons and in the sympathetic-, parasympathetic- and sensory ganglia of the embryonic PNS. Expressed in the developing neural epithelia of the inner ear, nasal cavity, tongue and retina. At day 16.5, expressed in various tissues including kidney and intestine. In contrast, isoform 2 is widely expressed at a low level throughout the adult testis. {ECO:0000269|PubMed:12052874, ECO:0000269|PubMed:8530418, ECO:0000269|PubMed:8595902, ECO:0000269|PubMed:8858600, ECO:0000269|PubMed:9071982, ECO:0000269|PubMed:9504722, ECO:0000269|PubMed:9694834}.
Induction:By ciliary neurotrophic factor (CNTF). Repressed by vitamin A. Induced by retinoic acid. {ECO:0000269|PubMed:19131575, ECO:0000269|PubMed:9694834}.
Developmental stage:Isoform 1 is highly expressed in early to midgestation embryos, with expression leveling off at 15 dpc. Expressed in yolk sac erythrocytes at 9.5 dpc. After birth, expression in the testes remains at a basal level until puberty, begins to increase at postnatal day 16 (P16) and peaks at P20 to P24. Expression is maintained at a high level throughout adulthood. Isoform 2 peaks transiently at P24. {ECO:0000269|PubMed:12093744, ECO:0000269|PubMed:8595902, ECO:0000269|PubMed:8858600, ECO:0000269|PubMed:9071982}.
Protein families:Nuclear hormone receptor family, NR2 subfamily