PR7D1_MOUSE P04769
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04769
Recommended name：Prolactin-7D1
EC number：
Alternative names：(Proliferin-related protein) (PRP)
Cleaved into：
GeneID：18814
Gene names (primary )：Prl7d1
Gene names (synonym )：Plfr
Gene names (ORF )：
Length：244
Mass：27952
Sequence：MLPSLIQPCSSGTLLMLLMSNLFLWEKVSSAPINASEAVLSDLKDLFDNATVLSGEMSKLGVIMRKEFFMNSFSSETFNKIILDLHKSTENITKAFNSCHTVPINVPETVEDVRKTSFEEFLKMVLHMLLAWKEPLKHLVTELSALPECPYRILSKAEAIEAKNKDLLEYIIRIISKVNPAIKENEDYPTWSDLDSLKSADKETQFFALYMFSFCLRIDLETVDFLVNFLKCLLLYDDVCYSEF
Tissue specificity：
Induction：
Developmental stage：PRP mRNA levels are highest in the fetal part of the placenta and peak at day 12 of gestation, decreasing gradually until term.
Protein families：Somatotropin/prolactin family