PMP22_MOUSE P16646
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16646
Recommended name：Peripheral myelin protein 22
EC number：
Alternative names：(PMP-22) (Growth arrest-specific protein 3) (GAS-3)
Cleaved into：
GeneID：18858
Gene names (primary )：Pmp22
Gene names (synonym )：Gas-3 Gas3 Pmp-22
Gene names (ORF )：
Length：161
Mass：18023
Sequence：MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHTTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLALFLFFCQLFTLTKGGRFYITGFFQILAGLCVMSAAAIYTVRHSEWHVNTDYSYGFAYILAWVAFPLALLSGIIYVILRKREL
Tissue specificity：Schwann cells of the peripheral nervous system.
Induction：
Developmental stage：Specifically expressed at growth arrest of mammalian cells.
Protein families：PMP-22/EMP/MP20 family