F168B_MOUSE Q80XQ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80XQ8
Recommended name：Myelin-associated neurite-outgrowth inhibitor
EC number：
Alternative names：(Mani)
Cleaved into：
GeneID：214469
Gene names (primary )：Fam168b
Gene names (synonym )：Kiaa4042
Gene names (ORF )：
Length：194
Mass：20194
Sequence：MNPVYSPGSSGVPYANAKGIGYPAGFPVGYAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGSGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW
Tissue specificity：Predominantly expressed in the brain, including olfactory bulb, cortex and cerebellum (at protein level). {ECO:0000269|PubMed:20716133}.
Induction：Up-regulated by different neurotrophins, including NGF and BDNF, but not by growth factors, such as EGF. {ECO:0000269|PubMed:20716133}.
Developmental stage：Specifically expressed in differentiated neurons, but absent from proliferating neural stem cells. {ECO:0000269|PubMed:20716133}.
Protein families：FAM168 family