HMGN3_MOUSE Q9DCB1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DCB1
Recommended name：High mobility group nucleosome-binding domain-containing protein 3
EC number：
Alternative names：
Cleaved into：
GeneID：94353
Gene names (primary )：Hmgn3
Gene names (synonym )：
Gene names (ORF )：
Length：99
Mass：10769
Sequence：MPKRKSPENTEGKDGTKLTKQEPTRRSARLSAKPVPPKPESKPRKTSAKKEPGTKISRGAKGKKEEKQEAGEEGTAPSANGDTKVEEAQRTESIEKEGE
Tissue specificity：Expressed in the brain, eye, prostate, thyroid, kidney, testis, glial cells and insulin-producing cells of the Langerhans pancreatic islets. In the brain, expressed in the lateral olfactory tract, anterior commissure, corpus callosum, internal capsule, fornix, stria medullans, optic tract, axon bundles, Purkinje cell layer and granular layer of the cerebellum. In retina, expressed in the nuclei of cells in the inner nuclear layer including amacrine, bipolar and horizontal neurons and in the nuclei of ganglion neurons. Detected at low levels in the liver. {ECO:0000269|PubMed:11356838, ECO:0000269|PubMed:12185205, ECO:0000269|PubMed:15082770, ECO:0000269|PubMed:18502697, ECO:0000269|PubMed:19651901, ECO:0000269|PubMed:19885867}.
Induction：
Developmental stage：Transiently expressed in the stroma and endothelium of the cornea at birth. Subsequently expressed in the corneal epithelium and the inner nuclear and ganglion cell layers of the retina. The predominant form in developing ocular tissues is isoform 2, although isoform 1 is also detectable. {ECO:0000269|PubMed:18502697}.
Protein families：HMGN family