CBY1_MOUSE Q9D1C2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1C2
Recommended name：Protein chibby homolog 1
EC number：
Alternative names：(Cytosolic leucine-rich protein) (PIGEA-14) (PKD2 interactor, Golgi and endoplasmic reticulum-associated 1)
Cleaved into：
GeneID：73739
Gene names (primary )：Cby1
Gene names (synonym )：Cby Pgea1
Gene names (ORF )：
Length：127
Mass：14535
Sequence：MPLFGSIFSPKKTPPRKSASLSNLHSLDRSTRELELGLDYGTPTMNLAGQSLKFENGQWVADSVISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLKDKELDELKVTNRRRK
Tissue specificity：Found in heart, brain, lung, liver, muscle, kidney and testis. Levels are approximately 3-fold higher in embryonic and adult heart than in lung or liver. {ECO:0000269|PubMed:17261658}.
Induction：
Developmental stage：Ubiquitously expressed in early stages of embryonic stem cell differentiation but decreases at later stages when high expression is restricted to cardiomyocytes. {ECO:0000269|PubMed:17261658}.
Protein families：Chibby family