SPAG4_MOUSE   Q9JJF2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJF2

Recommended name:Sperm-associated antigen 4 protein

EC number:

Alternative names:(Outer dense fiber-associated protein SPAG4) (SUN domain-containing protein 4)

Cleaved into:

GeneID:245865

Gene names  (primary ):Spag4

Gene names  (synonym ):

Gene names  (ORF ):MNCb-0953 Sun4

Length:443

Mass:48582

Sequence:MRRSPRSGSAASSHNHTPNFYSENSNSSHSATSGDSNGRRSAGPELGEPEGRRARGSSCGEPALSPGMPGGDTWAGSSRPKLAPRSHNGQTACGAATVRGGASEPSGSSVVLEEQLNLLPILDLRQEMPTPRVSKSFLSLLFQVLSMVLSLAVDGLVCVCREICSIRFLFTAVSLLSIFLAALWWGLLYLIPPLENEPTEMLTLSQYHHRVHSQGQQLQQLQAELNKLHKEVSSVRAAHSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYEDQNTAYFWNRLSFWNYARPPSVILEPDVFPGNCWAFEGDKGQVVIRLPGHVQLSDITLQHPPPTVAHTGGASSAPRDFAVYGLQADDETEVFLGKFIFDVQKSEIQTFHLQNDPPSAFPKVKIQILSNWGHPRFTCLYRVRAHGVRTSEWADDNATGVTGGPH

Tissue specificity:Isoform 1 is testis specific and is exclusively expressed in spermatids. {ECO:0000269|PubMed:10373309, ECO:0000269|PubMed:26621829}.

Induction:

Developmental stage:Weakly expressed at day 18 p.p. and increased expression at day 21-25 p.p. with increasing spermatid numbers. {ECO:0000269|PubMed:26621829}.

Protein families:


   💬 WhatsApp