OXDD_RAT D3ZDM7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3ZDM7
Recommended name：D-aspartate oxidase
EC number：EC:1.4.3.1
Alternative names：DASOX Curated; DASPO By Similarity; DDO Curated
Cleaved into：
GeneID：685325
Gene names (primary )：Ddo
Gene names (synonym )：LOC100911156 Imported
Gene names (ORF )：
Length：341
Mass：37,543
Sequence：MDTVRIAVVGAGVIGLSTAACVSQLVPRCSVTVISDRFTPDTTSNVAAGMLIPPTYPDTPVPTLKRWFRETFQHLSEIARSAEAVDAGIHLVSGWQIFRSVPTEEVPFWADVVLGFREMTEAELKRFPQYEFGQAFTTLKCETSAYLPWLEKRIKGSGGLLLTRRIEDLWELQPSFDIVVNCSGLGSRRLVGDATVSPVRGQVLQAQAPWVKHFIRDGGGLTYVYPGTSYVTLGGSRQTGDWNLSPDAELSREIFSRCCALEPSLHRACDIKEKVGLRPSRPGVRLQKEILVRGEQRLPVVHNYGHGSGGISVHWGSALEATRLVMECVHTLRTPASLSKL
Tissue specificity：Expressed in liver and kidney (at protein level) (PubMed:1991137). In the brain, expressed in the frontal, temporal, and occipital lobes of the cortex, hippocampus, striatum, diencephalon, brainstem, cerebellum, spinal cord, plexus choroiderus and ependyma (at protein level) (PubMed:12209855, PubMed:1991137). Also expressed in the lung, muscle, heart, spleen, small intestine and testis (at protein level) (PubMed:1991137). 2 s
Induction：In the liver and kidney, progressively increases during postnatal stages (at protein level). 1 Publication
Developmental stage：Increased in pups born to mothers fed D-aspartate during pregnancy and suckling; not induced when mothers fed D-alanine. 1
Protein families：